About PREP Blocking Peptide

Check information

Catalog number: 33R-9102

Full name: PREP Blocking Peptide

Size: 100 ug

Supplier:  fitzgerald

Price: 280.00

Product Type : Proteins

Product Subtype : Blocking Peptides

Research Area : Proteases, Inhibitors, & Enzymes

Tag/Conjugate : THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Type1 : Synthetic

Form & Buffer : Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage : Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

Applications : WB, IHC

Shipping Info : Blue Ice

Test : You can block the antibody by the specific target amino acid sequence of peptide.

Properties : blocking peptide

Description : Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.