PREP Blocking Peptide

Explore list and go deeper

 

Check Our Product

see more details & buy online

About PREP Blocking Peptide

Check information

Catalog number: 33R-9102

Full name: PREP Blocking Peptide

Size: 100 ug

Supplier:  fitzgerald

Price: 280.00

Product Type: Proteins

Product Subtype: Blocking Peptides

Research Area: Proteases, Inhibitors, & Enzymes

Tag/Conjugate: THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Type1: Synthetic

Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage: Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

Applications: WB, IHC

Shipping Info: Blue Ice

Test: You can block the antibody by the specific target amino acid sequence of peptide.

Properties: blocking peptide

Description: Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.